PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009762039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 246aa    MW: 27801.8 Da    PI: 8.6713
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009762039.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.44.1e-2955112260
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     + ++YkeCl NhAa++Gg+a+DGCgEfmps geegt + l+C+ C+CHRnFHR+e+e e
  XP_009762039.1  55 KMMKYKECLENHAAAMGGNATDGCGEFMPS-GEEGTFEFLTCSVCNCHRNFHRKETEGE 112
                     5789*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2457114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.9E-2657109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.9E-2858108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.67959108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.13E-15171231IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-25173233IPR009057Homeodomain-like
TIGRFAMsTIGR015652.5E-24177231IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEVPNEEGEM AMPINSAYGH GHMIHHDPAP QNNHIIPSSQ IITSKNGPPI SSNKKMMKYK  60
ECLENHAAAM GGNATDGCGE FMPSGEEGTF EFLTCSVCNC HRNFHRKETE GELVRKVYVG  120
HPHKAFVYPA SRAAPHQMIM SYNNHMGSIP GINQEDGIIN GGCGVMARPL NYQQLVKKRF  180
RTKFSQEQKE KMLNFAEKIG WKMQKQEEAM VQQFCQQVGV KRRLLKVWMH NLAKKNSNDI  240
NTESQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-211782311871ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762039.10.0PREDICTED: zinc-finger homeodomain protein 4-like isoform X1
RefseqXP_016437760.10.0PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S07e-69ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A061GFH03e-96A0A061GFH0_THECC; Homeobox protein 31
TrEMBLA0A068TN673e-96A0A068TN67_COFCA; Uncharacterized protein
STRINGVIT_12s0035g01880.t012e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-70homeobox protein 31